PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa18g002440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 490aa    MW: 55048.2 Da    PI: 7.8552
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa18g002440.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox567e-18332386256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++k+q   Lee F+++++++ +++  LAkkl+Lt rqV vWFqNrRa+ k
  Csa18g002440.1 332 RKKLRLSKDQSAFLEETFKEHNTLNPKQKLALAKKLNLTARQVEVWFQNRRARTK 386
                     788899***********************************************98 PP

2HD-ZIP_I/II1192.5e-38332421191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlsk+q+++LEe+F+e+++L+p++K +la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke  eLr +l
  Csa18g002440.1 332 RKKLRLSKDQSAFLEETFKEHNTLNPKQKLALAKKLNLTARQVEVWFQNRRARTKLKQTEVDCEYLKRCVEKLTEENRRLQKEAMELR-TL 421
                     69*************************************************************************************9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.3E-2143133IPR006712HD-ZIP protein, N-terminal
PfamPF046184.3E-21208298IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.6E-18313389IPR009057Homeodomain-like
SuperFamilySSF466892.01E-18315389IPR009057Homeodomain-like
PROSITE profilePS5007117.313328388IPR001356Homeobox domain
SMARTSM003896.9E-16330392IPR001356Homeobox domain
PfamPF000462.3E-15332386IPR001356Homeobox domain
CDDcd000865.85E-15332389No hitNo description
PROSITE patternPS000270363386IPR017970Homeobox, conserved site
SMARTSM003401.1E-23388431IPR003106Leucine zipper, homeobox-associated
PfamPF021838.4E-8388421IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
KDHLLQVETT HLYHLSGYFL SLTQKKKIKP FFFFKLLSSL RMMMGKEDLG LSLSLGGSSQ  60
NNNPLQRNLN QNSSLSNNLQ RFPWNQTFDP TSDLRKIDVN SFPSTANCEE ETGVSSPNST  120
ISSTISGKRS EREGMSGTGD DHDEITPDRG YSRGTSDEDD DGGETSRKKL RLSKDQSAFL  180
EETFKEHNTL NPIKPFFFFK LLSSLRMMMG KEDLGLSLSL GGSSQNNNPL QRNLNQNSSL  240
SNNLQRFPWN QTFDPTSDLR KIDVNSFPST ANCEEETGVS SPNSTISSTI SGKRSEREGM  300
SGTGDDHDEI TPDRGYSRGT SDEDDDGGET SRKKLRLSKD QSAFLEETFK EHNTLNPKQK  360
LALAKKLNLT ARQVEVWFQN RRARTKLKQT EVDCEYLKRC VEKLTEENRR LQKEAMELRT  420
LKLSPQFYGQ MTPPTTLIMC PSCERVAGPS SSSSNHHHQN HRPVSINPWV ACAGQVAHGL  480
NFEALRPRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1330336SRKKLRL
2380388RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4284500.0AF428450.1 Arabidopsis thaliana AT5g47370/MQL5_23 mRNA, complete cds.
GenBankAJ4311830.0AJ431183.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT2 (hat2 gene).
GenBankAY0523240.0AY052324.1 Arabidopsis thaliana AT5g47370/MQL5_23 mRNA, complete cds.
GenBankAY0619040.0AY061904.1 Arabidopsis thaliana AT5g47370/MQL5_23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010441471.10.0PREDICTED: homeobox-leucine zipper protein HAT2
SwissprotP466010.0HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLD7MPU40.0D7MPU4_ARALL; Putative uncharacterized protein
STRINGAT5G47370.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15632690
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47370.11e-127Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein